Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterstitial collagenase
LigandBDBM50175543
Substrate/Competitorn/a
Meas. Tech.ChEMBL_320812
Ki 33±n/a nM
Citation Alberts ILTodorov NPDean PM Receptor flexibility in de novo ligand design and docking. J Med Chem 48:6585-96 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interstitial collagenase
Name:Interstitial collagenase
Synonyms:Fibroblast collagenase | MMP1 | Matrix metalloproteinase-1 | Matrix metalloproteinase-1 (MMP-1)
Type:Enzyme
Mol. Mass.:54010.26
Organism:Homo sapiens (Human)
Description:
Residue:469
Sequence:
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50175543
n/a
NameBDBM50175543
Synonyms:CHEMBL198662 | N-Hydroxy-3-(4-methoxy-benzenesulfonyl)-propionamide
TypeSmall organic molecule
Emp. Form.C10H13NO5S
Mol. Mass.259.279
SMILESCOc1ccc(cc1)S(=O)(=O)CCC(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: