Reaction Details |
 | Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50175737 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_328876 |
---|
Ki | 31±n/a nM |
---|
Citation | Trabanco AA; Pullan S; Alonso JM; Alvarez RM; Andrés JI; Boeckx I; Fernández J; Gómez A; Iturrino L; Janssens FE; Leenaerts JE; De Lucas AI; Matesanz E; Meert T; Steckler T 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. Bioorg Med Chem Lett 16:146-9 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Opioid receptors; mu/kappa/delta |
Synonyms: | D-OR-1 | DOR-1 | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50175737 |
---|
n/a |
---|
Name | BDBM50175737 |
Synonyms: | 4-(1-benzyl-1H-imidazol-2-yl)-N-(2-methoxyphenyl)-4-phenylpiperidine-1-carboxamide | CHEMBL199378 |
Type | Small organic molecule |
Emp. Form. | C29H30N4O2 |
Mol. Mass. | 466.5741 |
SMILES | COc1ccccc1NC(=O)N1CCC(CC1)(c1nccn1Cc1ccccc1)c1ccccc1 |
Structure |
|