| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50175723 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_328881 |
|---|
| EC50 | 776±n/a nM |
|---|
| Citation |  Trabanco AA; Pullan S; Alonso JM; Alvarez RM; Andrés JI; Boeckx I; Fernández J; Gómez A; Iturrino L; Janssens FE; Leenaerts JE; De Lucas AI; Matesanz E; Meert T; Steckler T 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. Bioorg Med Chem Lett 16:146-9 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50175723 |
|---|
| n/a |
|---|
| Name | BDBM50175723 |
|---|
| Synonyms: | 4-(1-benzyl-1H-imidazol-2-yl)-N-methyl-N,4-diphenylpiperidine-1-carboxamide | CHEMBL199433 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H30N4O |
|---|
| Mol. Mass. | 450.5747 |
|---|
| SMILES | CN(C(=O)N1CCC(CC1)(c1nccn1Cc1ccccc1)c1ccccc1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
