Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50175720 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_328876 (CHEMBL859855) |
---|
Ki | 99±n/a nM |
---|
Citation | Trabanco, AA; Pullan, S; Alonso, JM; Alvarez, RM; Andrés, JI; Boeckx, I; Fernández, J; Gómez, A; Iturrino, L; Janssens, FE; Leenaerts, JE; De Lucas, AI; Matesanz, E; Meert, T; Steckler, T 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. Bioorg Med Chem Lett16:146-9 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50175720 |
---|
n/a |
---|
Name | BDBM50175720 |
Synonyms: | 4-(1-benzyl-1H-imidazol-2-yl)-4-phenylpiperidine-1-carboxamide | CHEMBL199294 |
Type | Small organic molecule |
Emp. Form. | C22H24N4O |
Mol. Mass. | 360.4522 |
SMILES | NC(=O)N1CCC(CC1)(c1nccn1Cc1ccccc1)c1ccccc1 |
Structure |
|