Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine transporters; Norepinephrine & serotonin
LigandBDBM50176034
Substrate/Competitorn/a
Meas. Tech.ChEMBL_320901
Ki 0.60±n/a nM
Citation Smid PCoolen HKKeizer HGvan Hes Rde Moes JPden Hartog APStork BPlekkenpol RHNiemann LCStroomer CNTulp MTvan Stuivenberg HHMcCreary ACHesselink MBHerremans AHKruse CG Synthesis, structure-activity relationships, and biological properties of 1-heteroaryl-4-[omega-(1H-indol-3-yl)alkyl]piperazines, novel potential antipsychotics combining potent dopamine D2 receptor antagonism with potent serotonin reuptake inhibition. J Med Chem 48:6855-69 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine transporters; Norepinephrine & serotonin
Name:Monoamine transporters; Norepinephrine & serotonin
Synonyms:5-HT Transporter | 5-HTT | 5HT transporter | 5HTT | Anandamid membrane transporter, AMT | Anandamide membrane transporter, AMT | Sodium-dependent serotonin transporter (SERT) | imipramine receptor
Type:Multi-pass membrane protein
Mol. Mass.:70168.43
Organism:Rattus norvegicus (rat)
Description:P31652
Residue:630
Sequence:
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEAS
HSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTII
AWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIH
QSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGA
TLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLT
LTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLIST
PGTLKERIIKSITPETPTEIPCGDIRMNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176034
n/a
NameBDBM50176034
Synonyms:8-{4-[3-(1H-Indol-3-yl)-propyl]-piperazin-1-yl}-4H-benzo[1,4]oxazin-3-one | CHEMBL198069
TypeSmall organic molecule
Emp. Form.C23H26N4O2
Mol. Mass.390.4781
SMILESO=C1COc2c(N1)cccc2N1CCN(CCCc2c[nH]c3ccccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: