Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM50095504
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321311
IC50 250±n/a nM
Citation Barreca MLFerro SRao ADe Luca LZappalà MMonforte AMDebyser ZWitvrouw MChimirri A Pharmacophore-based design of HIV-1 integrase strand-transfer inhibitors. J Med Chem 48:7084-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50095504
n/a
NameBDBM50095504
Synonyms:4-[3-(3-Fluoro-benzyl)-phenyl]-2,4-dioxo-butyric acid | CHEMBL144727 | CHEMBL198000
TypeSmall organic molecule
Emp. Form.C17H13FO4
Mol. Mass.300.2811
SMILESOC(=O)C(=O)CC(=O)c1cccc(Cc2cccc(F)c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: