Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 3 (LPAR3)
LigandBDBM50176393
Substrate/Competitorn/a
Meas. Tech.ChEMBL_333864
Ki 119±n/a nM
Citation Durgam GGTsukahara RMakarova NWalker MDFujiwara YPigg KRBaker DLSardar VMParrill ALTigyi GMiller DD Synthesis and pharmacological evaluation of second-generation phosphatidic acid derivatives as lysophosphatidic acid receptor ligands. Bioorg Med Chem Lett 16:633-40 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 3 (LPAR3)
Name:Lysophosphatidic acid receptor 1/3
Synonyms:Lysophosphatidic acid receptor Edg-7
Type:Enzyme
Mol. Mass.:40149.72
Organism:Homo sapiens (Human)
Description:Q9UBY5
Residue:353
Sequence:
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176393
n/a
NameBDBM50176393
Synonyms:CHEMBL383095 | octanoic acid (S)-2-octanoyloxy-3-phosphonooxy-propyl ester
TypeSmall organic molecule
Emp. Form.C19H37O8P
Mol. Mass.424.466
SMILESCCCCCCCC(=O)OC[C@@H](COP(O)(O)=O)OC(=O)CCCCCCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: