Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 1
LigandBDBM50176392
Substrate/Competitorn/a
Meas. Tech.ChEMBL_333862
Ki 2850±n/a nM
Citation Durgam GGTsukahara RMakarova NWalker MDFujiwara YPigg KRBaker DLSardar VMParrill ALTigyi GMiller DD Synthesis and pharmacological evaluation of second-generation phosphatidic acid derivatives as lysophosphatidic acid receptor ligands. Bioorg Med Chem Lett 16:633-40 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 1
Name:Lysophosphatidic acid receptor 1
Synonyms:LPA receptor 1 | LPA-1 | LPAR1 | Lysophosphatidic acid receptor 1 (LPA1) | Lysophosphatidic acid receptor Edg-2
Type:Enzyme
Mol. Mass.:41120.55
Organism:Homo sapiens (Human)
Description:Q92633
Residue:364
Sequence:
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176392
n/a
NameBDBM50176392
Synonyms:CHEMBL379248 | thiophosphoric acid (R)-2-octanoylamino-2-octylcarbamoyl-ethyl ester
TypeSmall organic molecule
Emp. Form.C19H39N2O5PS
Mol. Mass.438.562
SMILESCCCCCCCCNC(=O)[C@@H](COP(O)(O)=S)NC(=O)CCCCCCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: