Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor alpha
LigandBDBM50176605
Substrate/Competitorn/a
Meas. Tech.ChEMBL_332329
EC50 1000±n/a nM
Citation Kasuga JMakishima MHashimoto YMiyachi H Design and synthesis of substituted phenylpropanoic acid derivatives as human peroxisome proliferator-activated receptor alpha/delta dual agonists. Bioorg Med Chem Lett 16:554-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor alpha
Name:Peroxisome proliferator-activated receptor alpha
Synonyms:Nuclear receptor subfamily 1 group C member 1 | PPAR-alpha
Type:PROTEIN
Mol. Mass.:52343.28
Organism:Mus musculus
Description:ChEMBL_572395
Residue:468
Sequence:
MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEESSGSFGFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPVIPASTDESPGSALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176605
n/a
NameBDBM50176605
Synonyms:(S)-2-(3-((3-fluoro-4-(trifluoromethyl)benzamido)methyl)-4-methoxybenzyl)butanoic acid | CHEMBL202118
TypeSmall organic molecule
Emp. Form.C21H21F4NO4
Mol. Mass.427.3894
SMILESCC[C@@H](Cc1ccc(OC)c(CNC(=O)c2ccc(c(F)c2)C(F)(F)F)c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: