Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A1 receptor
LigandBDBM50176839
Substrate/Competitorn/a
Meas. Tech.ChEMBL_430784
Ki 44±n/a nM
Citation Manetti FSchenone SBondavalli FBrullo CBruno ORanise AMosti LMenozzi GFossa PTrincavelli MLMartini CMartinelli ATintori CBotta M Synthesis and 3D QSAR of new pyrazolo[3,4-b]pyridines: potent and selective inhibitors of A1 adenosine receptors. J Med Chem 48:7172-85 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A1 receptor
Name:Adenosine A1 receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low
Type:Enzyme Catalytic Domain
Mol. Mass.:36602.99
Organism:BOVINE
Description:ADENOSINE 0 BOVINE::P28190
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPRTYFHTCLKVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAVVAITGCWILSFVVGLTPMFGWNNLSAVERDWLANGSVGEPVIECQFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPVDEDAPAERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176839
n/a
NameBDBM50176839
Synonyms:CHEMBL223821 | isopropyl 4-(2-chlorophenethylamino)-1-(2-chloro-2-phenylethyl)-1H-pyrazolo[3,4-b]pyridine-5-carboxylate
TypeSmall organic molecule
Emp. Form.C26H26Cl2N4O2
Mol. Mass.497.416
SMILESCC(C)OC(=O)c1cnc2n(CC(Cl)c3ccccc3)ncc2c1NCCc1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: