Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50176980
Substrate/Competitorn/a
Meas. Tech.ChEMBL_430952
Ki 2±n/a nM
Citation Murineddu GRuiu SLoriga GManca ILazzari PReali RPani LToma LPinna GA Tricyclic pyrazoles. 3. Synthesis, biological evaluation, and molecular modeling of analogues of the cannabinoid antagonist 8-chloro-1-(2',4'-dichlorophenyl)-N-piperidin-1-yl-1,4,5,6-tetrahydrobenzo[6,7]cyclohepta[1,2-c]pyrazole-3-carboxamide. J Med Chem 48:7351-62 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | mCB2
Type:Enzyme Catalytic Domain
Mol. Mass.:38220.43
Organism:MOUSE
Description:P47936
Residue:347
Sequence:
MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILS
SRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLD
VRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYA
LRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176980
n/a
NameBDBM50176980
Synonyms:8-chloro-1-(2',4'-dichlorophenyl)-N-homopiperidin-1-yl-1,4,5,6-tetrahydrobenzo[6,7]cyclohepta[1,2-c]pyrazole-3-carboxamide | CHEMBL223278
TypeSmall organic molecule
Emp. Form.C25H25Cl3N4O
Mol. Mass.503.851
SMILESClc1ccc(c(Cl)c1)-n1nc(C(=O)NN2CCCCCC2)c2CCCc3cc(Cl)ccc3-c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: