Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholine receptor protein epsilon chain
LigandBDBM8961
Substrate/Competitorn/a
Meas. Tech.ChEMBL_431077
IC50 44±n/a nM
Citation Kapková PHeller EUnger MFolkers GHolzgrabe U Random chemistry as a new tool for the generation of small compound libraries: development of a new acetylcholinesterase inhibitor. J Med Chem 48:7496-9 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholine receptor protein epsilon chain
Name:Nicotinic acetylcholine receptor alpha-1/beta-1/delta/epsilon
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:54686.87
Organism:Homo sapiens (Human)
Description:ChEMBL_431077
Residue:493
Sequence:
MARAPLGVLLLLGLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNL
ISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQF
GVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTF
AVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKP
LFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLS
VPLLGRFLIFVMVVATLIVMNCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPP
EAPRAASPPRRASSVGLLLRAEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEV
RCCVDAVNFVAESTRDQEATGEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFN
RVPDLPYAPCIQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8961
n/a
NameBDBM8961
Synonyms:1,2,3,4-tetrahydro-9-acridinamine | 1,2,3,4-tetrahydroacridin-9-amine | 9-THA | 9-amino-1,2,3,4-tetrahydroacridine (THA) | CHEMBL1337960 | CHEMBL95 | Cognex | Tacrine | Tracine | US8999994, Tacrine | cid_1935 | tacrine.HCl
TypeSmall organic molecule
Emp. Form.C13H14N2
Mol. Mass.198.2637
SMILESNc1c2CCCCc2nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: