Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor Edg-4
LigandBDBM50177331
Substrate/Competitorn/a
Meas. Tech.ChEMBL_329845
Ki 745±n/a nM
Citation Gududuru VZeng KTsukahara RMakarova NFujiwara YPigg KRBaker DLTigyi GMiller DD Identification of Darmstoff analogs as selective agonists and antagonists of lysophosphatidic acid receptors. Bioorg Med Chem Lett 16:451-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor Edg-4
Name:Lysophosphatidic acid receptor Edg-4
Synonyms:LPA receptor 2 | LPA-2 | Lysophosphatidic acid receptor 2
Type:PROTEIN
Mol. Mass.:39103.44
Organism:Homo sapiens (Human)
Description:ChEMBL_1451385
Residue:351
Sequence:
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177331
n/a
NameBDBM50177331
Synonyms:CHEMBL381470 | potassium (2-dodecyl-1,3-dioxolan-4-yl)methyl hydrogenphosphate
TypeSmall organic molecule
Emp. Form.C16H32O6P
Mol. Mass.351.396
SMILESCCCCCCCCCCCCC1OCC(COP(O)([O-])=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: