Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 1/lysophosphatidic acid receptor 3
LigandBDBM50177340
Substrate/Competitorn/a
Meas. Tech.ChEMBL_329846
Ki 241±n/a nM
Citation Gududuru VZeng KTsukahara RMakarova NFujiwara YPigg KRBaker DLTigyi GMiller DD Identification of Darmstoff analogs as selective agonists and antagonists of lysophosphatidic acid receptors. Bioorg Med Chem Lett 16:451-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 1/lysophosphatidic acid receptor 3
Name:Lysophosphatidic acid receptor 1/lysophosphatidic acid receptor 3
Synonyms:Lysophosphatidic acid receptor Edg-7
Type:PROTEIN
Mol. Mass.:40307.81
Organism:Rattus norvegicus
Description:ChEMBL_329846
Residue:354
Sequence:
MNECHYDKRMDFFYNRSNTDTADEWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVITNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWLLRQGLLDTSLTASLANL
LVIAVERHMSIMRMRIHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLIFWTVSNLLAFFIMVVVYVRIYMYVKRKTNVLSPHTSGSISRRRAPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCKQCNVQHVKRWFLLLALLNSVMNPIIYSYKDEDM
YNTMRKMICCAPHDSNAERHPSRIPSTIHSRSDTGSQYLEDSISQGQVCNKSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177340
n/a
NameBDBM50177340
Synonyms:CHEMBL382116 | potassium ((2R,4S)-2-(heptadec-9-enyl)-1,3-dioxolan-4-yl)methyl hydrogenphosphate
TypeSmall organic molecule
Emp. Form.C21H40O6P
Mol. Mass.419.513
SMILESCCCCCCC\C=C\CCCCCCCC[C@@H]1OC[C@@H](COP(O)([O-])=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: