| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin S |
|---|
| Ligand | BDBM50177771 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_325795 (CHEMBL862701) |
|---|
| Ki | 3900±n/a nM |
|---|
| Citation |  Palmer, JT; Bryant, C; Wang, DX; Davis, DE; Setti, EL; Rydzewski, RM; Venkatraman, S; Tian, ZQ; Burrill, LC; Mendonca, RV; Springman, E; McCarter, J; Chung, T; Cheung, H; Janc, JW; McGrath, M; Somoza, JR; Enriquez, P; Yu, ZW; Strickley, RM; Liu, L; Venuti, MC; Percival, MD; Falgueyret, JP; Prasit, P; Oballa, R; Riendeau, D; Young, RN; Wesolowski, G; Rodan, SB; Johnson, C; Kimmel, DB; Rodan, G Design and synthesis of tri-ring P3 benzamide-containing aminonitriles as potent, selective, orally effective inhibitors of cathepsin K. J Med Chem48:7520-34 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin S |
|---|
| Name: | Cathepsin S |
|---|
| Synonyms: | CATS_HUMAN | CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 37507.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25774 |
|---|
| Residue: | 331 |
|---|
| Sequence: | MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
|
|
|
|---|
| BDBM50177771 |
|---|
| n/a |
|---|
| Name | BDBM50177771 |
|---|
| Synonyms: | 4'-(4-tert-Butylamino-piperidin-1-yl)-biphenyl-4-carboxylic acid [1-(cyanomethyl-carbamoyl)-cyclohexyl]-amide | CHEMBL199163 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H41N5O2 |
|---|
| Mol. Mass. | 515.6895 |
|---|
| SMILES | CC(C)(C)NC1CCN(CC1)c1ccc(cc1)-c1ccc(cc1)C(=O)NC1(CCCCC1)C(=O)NCC#N |
|---|
| Structure | 
|
|---|
Search and Browse
