Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM50410595
Substrate/Competitorn/a
Meas. Tech.ChEMBL_325792
Ki 1.4±n/a nM
Citation Palmer JTBryant CWang DXDavis DESetti ELRydzewski RMVenkatraman STian ZQBurrill LCMendonca RVSpringman EMcCarter JChung TCheung HJanc JWMcGrath MSomoza JREnriquez PYu ZWStrickley RMLiu LVenuti MCPercival MDFalgueyret JPPrasit POballa RRiendeau DYoung RNWesolowski GRodan SBJohnson CKimmel DBRodan G Design and synthesis of tri-ring P3 benzamide-containing aminonitriles as potent, selective, orally effective inhibitors of cathepsin K. J Med Chem 48:7520-34 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:n/a
Type:Enzyme
Mol. Mass.:36879.51
Organism:Oryctolagus cuniculus (rabbit)
Description:n/a
Residue:329
Sequence:
MWGLKVLLLPVVSFALHPEEILDTQWELWKKTYSKQYNSKVDEISRRLIWEKNLKHISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPPSRSHSNDTLYIPDWEGRTPDSID
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENYGCGGG
YMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQKGNKHWIIKNSWGE
SWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50410595
n/a
NameBDBM50410595
Synonyms:CHEMBL200507
TypeSmall organic molecule
Emp. Form.C23H28N6O2S
Mol. Mass.452.572
SMILESN[C@@H]1CCN(C1)c1nc(cs1)-c1ccc(cc1)C(=O)NC1(CCCCC1)C(=O)NCC#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: