Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor (2b and 2c)
LigandBDBM50169264
Substrate/Competitorn/a
Meas. Tech.ChEMBL_340093
Ki 3.2±n/a nM
Citation Richter HGAdams DRBenardeau ABickerdike MJBentley JMBlench TJCliffe IADourish CHebeisen PKennett GAKnight ARMalcolm CSMattei PMisra AMizrahi JMonck NJPlancher JMRoever SRoffey JRTaylor SVickers SP Synthesis and biological evaluation of novel hexahydro-pyrido[3',2':4,5]pyrrolo[1,2-a]pyrazines as potent and selective 5-HT(2C) receptor agonists. Bioorg Med Chem Lett 16:1207-11 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin receptor (2b and 2c)
Name:Serotonin receptor (2b and 2c)
Synonyms:5-HT-2B | 5-HT2B | 5-hydroxytryptamine (serotonin) receptor 2B [Homo sapiens] | 5-hydroxytryptamine receptor 2B | 5-hydroxytryptamine receptor 2B (5-HT2B) | 5-hydroxytryptamine receptor 2C (5HT2C) | Serotonin (5-HT3) receptor | Serotonin 2b (5-HT2b) receptor | Serotonin Receptor 2B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:54312.47
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells.
Residue:481
Sequence:
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50169264
n/a
NameBDBM50169264
Synonyms:(4R,10aR)-7-Chloro-4,6-dimethyl-1,2,3,4,10,10a-hexahydro-pyrazino[1,2-a]indole | (4R,10aR)-7-chloro-4,6-dimethyl-1,2,3,4,10,10a-hexahydropyrazino[1,2-a]indole | CHEMBL190699
TypeSmall organic molecule
Emp. Form.C13H17ClN2
Mol. Mass.236.74
SMILESC[C@@H]1CNC[C@H]2Cc3ccc(Cl)c(C)c3N12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: