| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1D |
|---|
| Ligand | BDBM50179073 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_340099 (CHEMBL861249) |
|---|
| Ki | >360±n/a nM |
|---|
| Citation |  Richter, HG; Adams, DR; Benardeau, A; Bickerdike, MJ; Bentley, JM; Blench, TJ; Cliffe, IA; Dourish, C; Hebeisen, P; Kennett, GA; Knight, AR; Malcolm, CS; Mattei, P; Misra, A; Mizrahi, J; Monck, NJ; Plancher, JM; Roever, S; Roffey, JR; Taylor, S; Vickers, SP Synthesis and biological evaluation of novel hexahydro-pyrido[3',2':4,5]pyrrolo[1,2-a]pyrazines as potent and selective 5-HT(2C) receptor agonists. Bioorg Med Chem Lett16:1207-11 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1D |
|---|
| Name: | 5-hydroxytryptamine receptor 1D |
|---|
| Synonyms: | 5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | 5HT1D_HUMAN | HTR1D | HTR1DA | HTRL | Serotonin (5-HT) receptor | Serotonin Receptor 1D |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41920.63 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells. |
|---|
| Residue: | 377 |
|---|
| Sequence: | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
|
|
|
|---|
| BDBM50179073 |
|---|
| n/a |
|---|
| Name | BDBM50179073 |
|---|
| Synonyms: | (4R,9aR)-6-Cyclopropylmethoxymethyl-4-methyl-1,2,3,4,9,9a-hexahydro-2,4a,5-triaza-fluorene | CHEMBL203013 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H23N3O |
|---|
| Mol. Mass. | 273.3733 |
|---|
| SMILES | C[C@@H]1CNC[C@H]2Cc3ccc(COCC4CC4)nc3N12 |
|---|
| Structure | 
|
|---|
Search and Browse
