Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 5A |
---|
Ligand | BDBM50179073 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_340102 (CHEMBL861252) |
---|
Ki | >720±n/a nM |
---|
Citation | Richter, HG; Adams, DR; Benardeau, A; Bickerdike, MJ; Bentley, JM; Blench, TJ; Cliffe, IA; Dourish, C; Hebeisen, P; Kennett, GA; Knight, AR; Malcolm, CS; Mattei, P; Misra, A; Mizrahi, J; Monck, NJ; Plancher, JM; Roever, S; Roffey, JR; Taylor, S; Vickers, SP Synthesis and biological evaluation of novel hexahydro-pyrido[3',2':4,5]pyrrolo[1,2-a]pyrazines as potent and selective 5-HT(2C) receptor agonists. Bioorg Med Chem Lett16:1207-11 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 5A |
---|
Name: | 5-hydroxytryptamine receptor 5A |
Synonyms: | 5-HT-5 | 5-HT-5A | 5-hydroxytryptamine receptor 5 (5-HT5) | 5-hydroxytryptamine receptor 5A (5-HT5A) | 5HT5A_HUMAN | HTR5A | Serotonin (5-HT) receptor | Serotonin receptor 5A |
Type: | Enzyme |
Mol. Mass.: | 40266.25 |
Organism: | Homo sapiens (Human) |
Description: | P47898 |
Residue: | 357 |
Sequence: | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
|
|
|
BDBM50179073 |
---|
n/a |
---|
Name | BDBM50179073 |
Synonyms: | (4R,9aR)-6-Cyclopropylmethoxymethyl-4-methyl-1,2,3,4,9,9a-hexahydro-2,4a,5-triaza-fluorene | CHEMBL203013 |
Type | Small organic molecule |
Emp. Form. | C16H23N3O |
Mol. Mass. | 273.3733 |
SMILES | C[C@@H]1CNC[C@H]2Cc3ccc(COCC4CC4)nc3N12 |
Structure |
|