| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50179188 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_325358 (CHEMBL861058) |
|---|
| IC50 | 77±n/a nM |
|---|
| Citation |  Balboni, G; Guerrini, R; Salvadori, S; Negri, L; Giannini, E; Bryant, SD; Jinsmaa, Y; Lazarus, LH Conversion of the potent delta-opioid agonist H-Dmt-Tic-NH-CH(2)-bid into delta-opioid antagonists by N(1)-benzimidazole alkylation(1). J Med Chem48:8112-4 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50179188 |
|---|
| n/a |
|---|
| Name | BDBM50179188 |
|---|
| Synonyms: | (S)-N-((1-(2-amino-2-oxoethyl)-1H-benzo[d]imidazol-2-yl)methyl)-2-((S)-2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanoyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide | CHEMBL322300 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H34N6O4 |
|---|
| Mol. Mass. | 554.6395 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2C[C@H]1C(=O)NCc1nc2ccccc2n1CC(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
