Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated calcium channel alpha2/delta subunit 1
LigandBDBM50179711
Substrate/Competitorn/a
Meas. Tech.ChEMBL_335548
Ki 20±n/a nM
Citation Mortell KHAnderson DJLynch JJNelson SLSarris KMcDonald HSabet RBaker SHonore PLee CHJarvis MFGopalakrishnan M Structure-activity relationships of alpha-amino acid ligands for the alpha2delta subunit of voltage-gated calcium channels. Bioorg Med Chem Lett 16:1138-41 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated calcium channel alpha2/delta subunit 1
Name:Voltage-gated calcium channel alpha2/delta subunit 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:124608.02
Organism:Mus musculus
Description:ChEMBL_335548
Residue:1103
Sequence:
MAAGCLLALTLTLFQSGLIGPSSEEPFPSPVTIKSWVDKMQEDLVTLAKTASGVTQLADI
YEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASN
EVVYYNAKDDLDPERNESEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVL
NELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRR
RPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD
VSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIML
FTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIR
INTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLK
NQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPTIN
LRKRRPNVQNPKSQEPVTLDFLDAELENEIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
DKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTF
IAPREYCNDLKPSDNNTEFLLNFNEFIDRKTPNNPSCNTDLINRILLDAGFTNELVQNYW
SKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYF
NKSGPGAYESGIMVSKAVELYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCD
CKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSMMRHLVNISLYAFNKSYDY
QSVCDPGAAPKQGAGHRSAYVPSIADILQIGWWATAAAWSILQQLLLSLTFPRLLEAVEM
EEDDFTASLSKQSCITEQTQYFFKNDTKSFSGLLDCGNCSRIFHVEKLMNTNLVFIMVES
KGTCPCDTRLLMQAEQTSDGPDPCDMVKQPRYRKGPDVCFDNNVLEDYTDCGGVSGLNPS
LWSIFGLQFILLWLVSGSRHYLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50179711
n/a
NameBDBM50179711
Synonyms:4-(2-bromobenzylthio)-2-aminobutanoic acid | CHEMBL204646
TypeSmall organic molecule
Emp. Form.C11H14BrNO2S
Mol. Mass.304.203
SMILESNC(CCSCc1ccccc1Br)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: