Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target17-beta-hydroxysteroid dehydrogenase type 3
LigandBDBM50179960
Substrate/Competitorn/a
Meas. Tech.ChEMBL_340362
IC50 0.5±n/a nM
Citation Fink BEGavai AVTokarski JSGoyal BMisra RXiao HYKimball SDHan WCNorris DSpires TEYou DGottardis MMLorenzi MVVite GD Identification of a novel series of tetrahydrodibenzazocines as inhibitors of 17beta-hydroxysteroid dehydrogenase type 3. Bioorg Med Chem Lett 16:1532-6 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
17-beta-hydroxysteroid dehydrogenase type 3
Name:Estradiol 17-beta-dehydrogenase 3
Synonyms:Estradiol 17-beta-dehydrogenase 3
Type:Enzyme
Mol. Mass.:34525.39
Organism:Homo sapiens (Human)
Description:P37058
Residue:310
Sequence:
MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGI
GKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKL
AGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLI
LNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLN
TNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYV
AYLKLNTKVR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50179960
n/a
NameBDBM50179960
Synonyms:1-[8-(2-acetyl-phenyl)-2-chloro-11,12-dihydro-6H-dibenzo[b,f]azocin-5-yl]-ethanone | CHEMBL206384
TypeSmall organic molecule
Emp. Form.C25H22ClNO2
Mol. Mass.403.901
SMILESCC(=O)N1Cc2cc(ccc2CCc2cc(Cl)ccc12)-c1ccccc1C(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: