Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50132025
Substrate/Competitorn/a
Meas. Tech.ChEMBL_329485
Ki 60.1±n/a nM
Citation Leopoldo MLacivita EDe Giorgio PColabufo NANiso MBerardi FPerrone R Design, synthesis, and binding affinities of potential positron emission tomography (PET) ligands for visualization of brain dopamine D3 receptors. J Med Chem 49:358-65 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132025
n/a
NameBDBM50132025
Synonyms:2-Oxo-2H-chromene-3-carboxylic acid {4-[4-(2-methoxy-phenyl)-piperazin-1-yl]-butyl}-amide | CHEMBL126780 | N-[4-[4-(2-methoxyphenyl)piperazin-1-yl]butyl]-2-oxo-2H-1-benzopyran-3-carboxamide
TypeSmall organic molecule
Emp. Form.C25H29N3O4
Mol. Mass.435.5155
SMILESCOc1ccccc1N1CCN(CCCCNC(=O)c2cc3ccccc3oc2=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: