Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase B
LigandBDBM50060582
Substrate/Competitorn/a
Meas. Tech.ChEMBL_330127
IC50>250000±n/a nM
Citation Ng CKObando DWidmer FWright LCSorrell TCJolliffe KA Correlation of antifungal activity with fungal phospholipase inhibition using a series of bisquaternary ammonium salts. J Med Chem 49:811-6 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase B
Name:Phospholipase B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:68557.23
Organism:Cryptococcus neoformans
Description:ChEMBL_330127
Residue:637
Sequence:
MSIITTAFALSLLATTAFAVPPETPRIELQAERGLGDQSYAPWQVDCPSNVTWIRNATTG
LGTGERAYIEAREKLVQPAIEQMMAARGLETPPRTPVIGVALAGGGYRAMLTGLGGIMGM
MNESTEASQSETGGWLDGVSYWSGLSGGSWATGSFMSNGGQLPTTLLENLWNIDSNLVFP
DDGKLSFYTNLYTETNAKSDLGFPVQITDIWGLAIGSHVLPEPYQLSNTPNLTFSSLPSV
VAALGNASLPMPIIVAADRKRREAGELVIAENATVWEFTPYEFGSWAFGSQYKSPGAFTP
IEYLGTSVDDGSPNGTCWKGFDQLSFVMGTSATLFNGAFLELNGTDSGLLTNLITAFLAD
LGEDQADISRIPNSFSNYNSGENPIYNLTYITLVDAGETNQNIPLEPLLVPTRDVDAIVA
FDSSYDSDYIWPNGTALRTTYERAKILAEHENTRVLMPEVPSMNGFVNGGYNSRPTFFGC
NDTTTPVIIYIPSYPWSFAANTSTYQLSYENNEANEMLLNGMRSLTLNHSVPTWPTCFAC
ALTDRSFMYTSENRSTTCQECFDTWCWAGDDNTTEPANYEPVINSVPPWLIANNLSIGMA
DAPGSNESTAGTASSGAAKMGVGMGMVALTAGLGLML
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060582
n/a
NameBDBM50060582
Synonyms:1,10-Bis(trimethyl ammonium)decane dibromide | 1,10-bis-(trimethyl ammonium) decane dibromide | CHEMBL1134 | DECAMETHONIUM | DECAMETHONIUM BROMIDE | Decamethonium Iodide | N,N,N'',N''-Tetramethyl-decane-1,10-diammonium; dibromide | N,N,N,N'',N'',N''-Hexamethyldecane-1,10-diammoniumdibromide | Syncurine | decane-1,10-bis(trimethylammonium bromide)
TypeSmall organic molecule
Emp. Form.C16H38N2
Mol. Mass.258.4852
SMILESC[N+](C)(C)CCCCCCCCCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: