Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase B
LigandBDBM50060533
Substrate/Competitorn/a
Meas. Tech.ChEMBL_330127
IC50>250000±n/a nM
Citation Ng CKObando DWidmer FWright LCSorrell TCJolliffe KA Correlation of antifungal activity with fungal phospholipase inhibition using a series of bisquaternary ammonium salts. J Med Chem 49:811-6 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase B
Name:Phospholipase B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:68557.23
Organism:Cryptococcus neoformans
Description:ChEMBL_330127
Residue:637
Sequence:
MSIITTAFALSLLATTAFAVPPETPRIELQAERGLGDQSYAPWQVDCPSNVTWIRNATTG
LGTGERAYIEAREKLVQPAIEQMMAARGLETPPRTPVIGVALAGGGYRAMLTGLGGIMGM
MNESTEASQSETGGWLDGVSYWSGLSGGSWATGSFMSNGGQLPTTLLENLWNIDSNLVFP
DDGKLSFYTNLYTETNAKSDLGFPVQITDIWGLAIGSHVLPEPYQLSNTPNLTFSSLPSV
VAALGNASLPMPIIVAADRKRREAGELVIAENATVWEFTPYEFGSWAFGSQYKSPGAFTP
IEYLGTSVDDGSPNGTCWKGFDQLSFVMGTSATLFNGAFLELNGTDSGLLTNLITAFLAD
LGEDQADISRIPNSFSNYNSGENPIYNLTYITLVDAGETNQNIPLEPLLVPTRDVDAIVA
FDSSYDSDYIWPNGTALRTTYERAKILAEHENTRVLMPEVPSMNGFVNGGYNSRPTFFGC
NDTTTPVIIYIPSYPWSFAANTSTYQLSYENNEANEMLLNGMRSLTLNHSVPTWPTCFAC
ALTDRSFMYTSENRSTTCQECFDTWCWAGDDNTTEPANYEPVINSVPPWLIANNLSIGMA
DAPGSNESTAGTASSGAAKMGVGMGMVALTAGLGLML
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060533
n/a
NameBDBM50060533
Synonyms:1,12-Bis(trimethyl ammonium)dodecane dibromide | 1,12-bis-(trimethyl ammonium) dodecane dibromide | CHEMBL119701 | Dodecamethonium | N,N,N,N',N',N'-Hexamethyl-1,12-dodecane diaminium dibromide | N,N,N,N',N',N'-Hexamethyldodecane-1,12-diammoniumdibromide | N1,N1,N1,N12,N12,N12-hexamethyldodecane-1,12-diaminium bromide | dodecane-1,12-bis(trimethylammonium bromide)
TypeSmall organic molecule
Emp. Form.C18H42N2
Mol. Mass.286.5384
SMILESC[N+](C)(C)CCCCCCCCCCCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: