Reaction Details |
| Report a problem with these data |
Target | Nociceptin receptor |
---|
Ligand | BDBM50181385 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_331362 (CHEMBL867087) |
---|
IC50 | >1000±n/a nM |
---|
Citation | Goto, Y; Arai-Otsuki, S; Tachibana, Y; Ichikawa, D; Ozaki, S; Takahashi, H; Iwasawa, Y; Okamoto, O; Okuda, S; Ohta, H; Sagara, T Identification of a novel spiropiperidine opioid receptor-like 1 antagonist class by a focused library approach featuring 3D-pharmacophore similarity. J Med Chem49:847-9 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nociceptin receptor |
---|
Name: | Nociceptin receptor |
Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40702.87 |
Organism: | Homo sapiens (Human) |
Description: | P41146 |
Residue: | 370 |
Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
BDBM50181385 |
---|
n/a |
---|
Name | BDBM50181385 |
Synonyms: | (2Z)-N-(3-{2,3-dihydrospiro[indene-1,4'-piperidine]-1'-yl}propyl)-3-(2-methoxyphenyl)prop-2-enamide | CHEMBL437128 |
Type | Small organic molecule |
Emp. Form. | C26H32N2O2 |
Mol. Mass. | 404.5445 |
SMILES | COc1ccccc1\C=C/C(=O)NCCCN1CCC2(CCc3ccccc23)CC1 |
Structure |
|