Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepatitis C virus NS5B RNA-dependent RNA polymerase
LigandBDBM50181569
Substrate/Competitorn/a
Meas. Tech.ChEMBL_330652
EC50 2492±n/a nM
Citation Tedesco RShaw ANBambal RChai DConcha NODarcy MGDhanak DFitch DMGates AGerhardt WGHalegoua DLHan CHofmann GAJohnston VKKaura ACLiu NKeenan RMLin-Goerke JSarisky RTWiggall KJZimmerman MNDuffy KJ 3-(1,1-dioxo-2H-(1,2,4)-benzothiadiazin-3-yl)-4-hydroxy-2(1H)-quinolinones, potent inhibitors of hepatitis C virus RNA-dependent RNA polymerase. J Med Chem 49:971-83 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hepatitis C virus NS5B RNA-dependent RNA polymerase
Name:Hepatitis C virus NS5B RNA-dependent RNA polymerase
Synonyms:NS5B protein
Type:Protein
Mol. Mass.:25173.95
Organism:Hepatitis C virus
Description:Q8JXU8
Residue:229
Sequence:
RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181569
n/a
NameBDBM50181569
Synonyms:CHEMBL425221 | [3-(1,1-dioxo-1,4-dihydrobenzo[1,2,4]thiadiazin-3-yl)-4-hydroxy-1-(3-methylbutyl)-1H-dihydroquinolin-6-ylamino]acetic acid
TypeSmall organic molecule
Emp. Form.C23H24N4O6S
Mol. Mass.484.525
SMILESCC(C)CCn1c2ccc(NCC(O)=O)cc2c(O)c(C2=Nc3ccccc3S(=O)(=O)N2)c1=O |t:21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: