Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepatitis C virus NS5B RNA-dependent RNA polymerase
LigandBDBM50181927
Substrate/Competitorn/a
Meas. Tech.ChEMBL_345619
IC50 840±n/a nM
Citation Ishida TSuzuki THirashima SMizutani KYoshida AAndo IIkeda SAdachi THashimoto H Benzimidazole inhibitors of hepatitis C virus NS5B polymerase: identification of 2-[(4-diarylmethoxy)phenyl]-benzimidazole. Bioorg Med Chem Lett 16:1859-63 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hepatitis C virus NS5B RNA-dependent RNA polymerase
Name:Hepatitis C virus NS5B RNA-dependent RNA polymerase
Synonyms:NS5B protein
Type:Protein
Mol. Mass.:25173.95
Organism:Hepatitis C virus
Description:Q8JXU8
Residue:229
Sequence:
RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181927
n/a
NameBDBM50181927
Synonyms:2-(4-(bis(4-fluorophenyl)methoxy)-2-fluorophenyl)-1-cyclohexyl-1H-benzo[d]imidazole-5-carboxylic acid | CHEMBL381828
TypeSmall organic molecule
Emp. Form.C33H27F3N2O3
Mol. Mass.556.5743
SMILESOC(=O)c1ccc2n(C3CCCCC3)c(nc2c1)-c1ccc(OC(c2ccc(F)cc2)c2ccc(F)cc2)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: