Reaction Details |
| Report a problem with these data |
Target | RNA-directed RNA polymerase |
---|
Ligand | BDBM50181954 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_347313 (CHEMBL865646) |
---|
IC50 | 1.7±n/a nM |
---|
Citation | Evans, KA; Chai, D; Graybill, TL; Burton, G; Sarisky, RT; Lin-Goerke, J; Johnston, VK; Rivero, RA An efficient, asymmetric solid-phase synthesis of benzothiadiazine-substituted tetramic acids: potent inhibitors of the hepatitis C virus RNA-dependent RNA polymerase. Bioorg Med Chem Lett16:2205-8 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
RNA-directed RNA polymerase |
---|
Name: | RNA-directed RNA polymerase |
Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
Type: | Protein |
Mol. Mass.: | 25173.95 |
Organism: | Hepatitis C virus |
Description: | Q8JXU8 |
Residue: | 229 |
Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
BDBM50181954 |
---|
n/a |
---|
Name | BDBM50181954 |
Synonyms: | (S)-5-tert-butyl-1-(3,3-dimethyl-butyl)-3-(1,1-dioxo-1,4-dihydro-1-benzo[1,2,4]thiadiazin-3-yl)-4-hydroxy-1,5-dihydro-pyrrol-2-one | CHEMBL204350 |
Type | Small organic molecule |
Emp. Form. | C21H29N3O4S |
Mol. Mass. | 419.538 |
SMILES | CC(C)(C)CCN1[C@H](C(=O)C(C1=O)C1=Nc2ccccc2S(=O)(=O)N1)C(C)(C)C |t:14| |
Structure |
|