| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H2 receptor |
|---|
| Ligand | BDBM50182020 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_346851 (CHEMBL861354) |
|---|
| Ki | 2126±n/a nM |
|---|
| Citation |  Prabhakaran, J; Parsey, RV; Majo, VJ; Hsiung, SC; Milak, MS; Tamir, H; Simpson, NR; Van Heertum, RL; Mann, JJ; Dileep Kumar, JS Synthesis, in vitro and in vivo evaluation of [O-methyl-11C] 2-{4-[4-(3-methoxyphenyl)piperazin-1-yl]-butyl}-4-methyl-2H-[1,2,4]-triazine-3,5-dione: a novel agonist 5-HT1A receptor PET ligand. Bioorg Med Chem Lett16:2101-4 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histamine H2 receptor |
|---|
| Name: | Histamine H2 receptor |
|---|
| Synonyms: | Gastric receptor I | H2R | HISTAMINE H2 | HRH2 | HRH2_HUMAN | Histamine H2 receptor | Histamine H2-Gs alpha S |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40115.31 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 359 |
|---|
| Sequence: | MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
|
|
|
|---|
| BDBM50182020 |
|---|
| n/a |
|---|
| Name | BDBM50182020 |
|---|
| Synonyms: | 2-(4-(4-(3-methoxyphenyl)piperazin-1-yl)butyl)-4-methyl-1,2,4-triazine-3,5(2H,4H)-dione | CHEMBL426317 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H27N5O3 |
|---|
| Mol. Mass. | 373.4494 |
|---|
| SMILES | COc1cccc(c1)N1CCN(CCCCn2ncc(=O)n(C)c2=O)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
