Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50182020 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_346843 (CHEMBL861833) |
---|
Ki | 180±n/a nM |
---|
Citation | Prabhakaran, J; Parsey, RV; Majo, VJ; Hsiung, SC; Milak, MS; Tamir, H; Simpson, NR; Van Heertum, RL; Mann, JJ; Dileep Kumar, JS Synthesis, in vitro and in vivo evaluation of [O-methyl-11C] 2-{4-[4-(3-methoxyphenyl)piperazin-1-yl]-butyl}-4-methyl-2H-[1,2,4]-triazine-3,5-dione: a novel agonist 5-HT1A receptor PET ligand. Bioorg Med Chem Lett16:2101-4 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50182020 |
---|
n/a |
---|
Name | BDBM50182020 |
Synonyms: | 2-(4-(4-(3-methoxyphenyl)piperazin-1-yl)butyl)-4-methyl-1,2,4-triazine-3,5(2H,4H)-dione | CHEMBL426317 |
Type | Small organic molecule |
Emp. Form. | C19H27N5O3 |
Mol. Mass. | 373.4494 |
SMILES | COc1cccc(c1)N1CCN(CCCCn2ncc(=O)n(C)c2=O)CC1 |
Structure |
|