| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HLA class II histocompatibility antigen gamma chain |
|---|
| Ligand | BDBM50182089 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_347360 (CHEMBL865649) |
|---|
| IC50 | 2700±n/a nM |
|---|
| Citation |  Grice, CA; Tays, K; Khatuya, H; Gustin, DJ; Butler, CR; Wei, J; Sehon, CA; Sun, S; Gu, Y; Jiang, W; Thurmond, RL; Karlsson, L; Edwards, JP The SAR of 4-substituted (6,6-bicyclic) piperidine cathepsin S inhibitors. Bioorg Med Chem Lett16:2209-12 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HLA class II histocompatibility antigen gamma chain |
|---|
| Name: | HLA class II histocompatibility antigen gamma chain |
|---|
| Synonyms: | CD74 | DHLAG | HG2A_HUMAN | HLA-DR antigens-associated invariant chain |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33525.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_347360 |
|---|
| Residue: | 296 |
|---|
| Sequence: | MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV
FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP
LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
|
|
|
|---|
| BDBM50182089 |
|---|
| n/a |
|---|
| Name | BDBM50182089 |
|---|
| Synonyms: | 1-[3-(4-Bromo-phenyl)-5-methanesulfonyl-4,5,6,7-tetrahydro-pyrazolo[4,3-c]pyridin-1-yl]-3-[4-(6-chloro-2,2-dioxo-3,4-dihydro-2H-2lambda*6*-benzo[1,2,6]thiadiazin-1-yl)-piperidin-1-yl]-propan-2-ol | CHEMBL379770 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H34BrClN6O5S2 |
|---|
| Mol. Mass. | 714.094 |
|---|
| SMILES | CS(=O)(=O)N1CCc2c(C1)c(nn2CC(O)CN1CCC(CC1)N1c2ccc(Cl)cc2CNS1(=O)=O)-c1ccc(Br)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
