Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetComplement C1s
LigandBDBM50182160
Substrate/Competitorn/a
Meas. Tech.ChEBML_347235
Ki 20±n/a nM
Citation Subasinghe NLTravins JMAli FHuang HBallentine SKMarugán JJKhalil EHufnagel HRBone RFDesJarlais RLCrysler CSNinan NCummings MDMolloy CJTomczuk BE A novel series of arylsulfonylthiophene-2-carboxamidine inhibitors of the complement component C1s. Bioorg Med Chem Lett 16:2200-4 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Complement C1s
Name:Complement C1s
Synonyms:C1 esterase | Complement C1s subcomponent | Complement C1s subcomponent heavy chain | Complement C1s subcomponent light chain | Complement component 1 subcomponent s | Trypsin | complement component 1, s subcomponent
Type:Protein
Mol. Mass.:76657.91
Organism:Homo sapiens (Human)
Description:P09871
Residue:688
Sequence:
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVF
VAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCG
TYGLYTRVKNYVDWIMKTMQENSTPRED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50182160
n/a
NameBDBM50182160
Synonyms:4-[7-bromo-1-(2,6-dichloro-benzyl)-1H-benzoimidazole-5-sulfonyl]-5-methylsulfanyl-thiophene-2-carboxamidine | CHEMBL377090
TypeSmall organic molecule
Emp. Form.C20H15BrCl2N4O2S3
Mol. Mass.590.364
SMILESCSc1sc(cc1S(=O)(=O)c1cc(Br)c2n(Cc3c(Cl)cccc3Cl)cnc2c1)C(N)=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: