Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclooxygenase-2
LigandBDBM50182339
Substrate/Competitorn/a
Meas. Tech.ChEMBL_344386
IC50 13±n/a nM
Citation Cheng HLundy DeMello KMLi JSakya SMAndo KKawamura KKato TRafka RJJaynes BHZiegler CBStevens RLund LAMann DWKilroy CHaven MLNimz ELDutra JKLi CMinich MLKolosko NLPetras CSilvia AMSeibel SB Synthesis and SAR of heteroaryl-phenyl-substituted pyrazole derivatives as highly selective and potent canine COX-2 inhibitors. Bioorg Med Chem Lett 16:2076-80 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclooxygenase-2
Name:Cyclooxygenase-2
Synonyms:Prostaglandin G/H synthase-2
Type:PROTEIN
Mol. Mass.:68982.35
Organism:Canis familiaris
Description:ChEMBL_344386
Residue:604
Sequence:
MLARALVLCAALAVVRAANPCCSHPCQNQGICMSTGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLYLKPTPNTVHYILTHFKGVWNIVNNIPFLRNTIMKYVLTSRSHLIESPPTYNVNY
GYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKMKY
QVIDGEVYPPTVKDTQVEMIYPPHVPEHLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFIYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYTSFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDGQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50182339
n/a
NameBDBM50182339
Synonyms:2-(furan-2-yl)-5-(1-(5-(methylsulfonyl)pyridin-2-yl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)benzonitrile | CHEMBL205351
TypeSmall organic molecule
Emp. Form.C21H13F3N4O3S
Mol. Mass.458.413
SMILESCS(=O)(=O)c1ccc(nc1)-n1nc(cc1-c1ccc(-c2ccco2)c(c1)C#N)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: