Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome CYP26A1
LigandBDBM50183242
Substrate/Competitorn/a
Meas. Tech.ChEMBL_355279
IC50 34±n/a nM
Citation Mulvihill MJKan JLCooke ABhagwat SBeck PBittner MCesario CKeane DLazarescu VNigro ANillson CPanicker BSmith VSrebernak MSun FLO'Connor MRusso SFischetti GVrkljan MWinski SCastelhano ALEmerson DGibson NW 3-[6-(2-Dimethylamino-1-imidazol-1-yl-butyl)-naphthalen-2-yloxy]-2,2-dimethyl-propionic acid as a highly potent and selective retinoic acid metabolic blocking agent. Bioorg Med Chem Lett 16:2729-33 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome CYP26A1
Name:Cytochrome CYP26A1
Synonyms:Cytochrome P450 26A1 | Cytochrome P450 retinoic acid-inactivating 1 | Retinoic acid 4-hydroxylase
Type:Enzyme
Mol. Mass.:56216.16
Organism:Homo sapiens (Human)
Description:O43174
Residue:497
Sequence:
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
NLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
YPVDNLPARFTHFHGEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183242
n/a
NameBDBM50183242
Synonyms:3-(6-((1R,2R)-1-(1H-imidazol-1-yl)-2-morpholinopropyl)naphthalen-2-yloxy)-2,2-dimethylpropanoic acid | CHEMBL208158
TypeSmall organic molecule
Emp. Form.C25H31N3O4
Mol. Mass.437.5313
SMILESC[C@H]([C@@H](c1ccc2cc(OCC(C)(C)C(O)=O)ccc2c1)n1ccnc1)N1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: