Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent dopamine transporter
LigandBDBM50183546
Substrate/Competitorn/a
Meas. Tech.ChEMBL_335142
Ki 1.3±n/a nM
Citation Greiner EBoos TLPrisinzano TEDe Martino MGZeglis BDersch CMMarcus JPartilla JSRothman RBJacobson AERice KC Design and synthesis of promiscuous high-affinity monoamine transporter ligands: unraveling transporter selectivity. J Med Chem 49:1766-72 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium-dependent dopamine transporter
Name:Sodium-dependent dopamine transporter
Synonyms:DA transporter | DAT | DAT1 | Dopamine transporter (DAT) | Dopamine transporter protein (DAT) | SLC6A3 | Sodium-dependent dopamine transporter (DAT) | Solute carrier family 6 member 3
Type:Multi-pass membrane protein
Mol. Mass.:68497.11
Organism:Homo sapiens (Human)
Description:Q01959
Residue:620
Sequence:
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183546
n/a
NameBDBM50183546
Synonyms:CHEMBL383071 | S-(+)-4-[2-[bis-(4-fluorophenyl)methoxy]ethyl]-1-(3-phenylbutyl)-piperidine oxalate
TypeSmall organic molecule
Emp. Form.C30H35F2NO
Mol. Mass.463.6018
SMILESC[C@@H](CCN1CCC(CCOC(c2ccc(F)cc2)c2ccc(F)cc2)CC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: