Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADAM17
LigandBDBM50183715
Substrate/Competitorn/a
Meas. Tech.ChEMBL_354453
Ki 0.350000±n/a nM
Citation Gilmore JLKing BWHarris CMaduskuie TMercer SELiu RQCovington MBQian MRibadeneria MDVaddi KTrzaskos JMNewton RCDecicco CPDuan JJ Synthesis and structure-activity relationship of a novel, achiral series of TNF-alpha converting enzyme inhibitors. Bioorg Med Chem Lett 16:2699-704 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ADAM17
Name:ADAM17
Synonyms:A disintegrin and metalloproteinase domain 17 | ADAM 17 | Snake venom-like protease | TNF-alpha-Converting Enzyme
Type:Metalloprotease
Mol. Mass.:12197.99
Organism:Sus scrofa (pig)
Description:Partially purified TACE was obtained from porcine spleen.
Residue:112
Sequence:
MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183715
n/a
NameBDBM50183715
Synonyms:CHEMBL207305 | N-(4-(2-(hydroxyamino)-2-oxoethyl)-tetrahydro-2H-pyran-4-yl)-4-((2-methylquinolin-4-yl)methoxy)benzamide | N-(4-(2-(hydroxyamino)-2-oxoethyl)tetrahydro-2H-pyran-4-yl)-4-((2-methylquinolin-4-yl)methoxy)benzamide
TypeSmall organic molecule
Emp. Form.C25H27N3O5
Mol. Mass.449.499
SMILESCc1cc(COc2ccc(cc2)C(=O)NC2(CC(=O)NO)CCOCC2)c2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: