Reaction Details |
| Report a problem with these data |
Target | Matrilysin |
---|
Ligand | BDBM50183715 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_354470 (CHEMBL853105) |
---|
Ki | 25±n/a nM |
---|
Citation | Gilmore, JL; King, BW; Harris, C; Maduskuie, T; Mercer, SE; Liu, RQ; Covington, MB; Qian, M; Ribadeneria, MD; Vaddi, K; Trzaskos, JM; Newton, RC; Decicco, CP; Duan, JJ Synthesis and structure-activity relationship of a novel, achiral series of TNF-alpha converting enzyme inhibitors. Bioorg Med Chem Lett16:2699-704 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Matrilysin |
---|
Name: | Matrilysin |
Synonyms: | MMP7 | MMP7_HUMAN | MPSL1 | Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7) | Matrix metalloproteinase-7 (MMP7) | PUMP1 |
Type: | Enzyme |
Mol. Mass.: | 29681.54 |
Organism: | Homo sapiens (Human) |
Description: | P09237 |
Residue: | 267 |
Sequence: | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
|
|
|
BDBM50183715 |
---|
n/a |
---|
Name | BDBM50183715 |
Synonyms: | CHEMBL207305 | N-(4-(2-(hydroxyamino)-2-oxoethyl)-tetrahydro-2H-pyran-4-yl)-4-((2-methylquinolin-4-yl)methoxy)benzamide | N-(4-(2-(hydroxyamino)-2-oxoethyl)tetrahydro-2H-pyran-4-yl)-4-((2-methylquinolin-4-yl)methoxy)benzamide |
Type | Small organic molecule |
Emp. Form. | C25H27N3O5 |
Mol. Mass. | 449.499 |
SMILES | Cc1cc(COc2ccc(cc2)C(=O)NC2(CC(=O)NO)CCOCC2)c2ccccc2n1 |
Structure |
|