Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhodesain
LigandBDBM50183742
Substrate/Competitorn/a
Meas. Tech.ChEMBL_350622
Ki 600±n/a nM
Citation Vicik RHoerr VGlaser MSchultheis MHansell EMcKerrow JHHolzgrabe UCaffrey CRPonte-Sucre AMoll HStich ASchirmeister T Aziridine-2,3-dicarboxylate inhibitors targeting the major cysteine protease of Trypanosoma brucei as lead trypanocidal agents. Bioorg Med Chem Lett 16:2753-7 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Rhodesain
Name:Rhodesain
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:48425.78
Organism:Trypanosoma brucei rhodesiense
Description:ChEMBL_619861
Residue:450
Sequence:
MPRTEMVRFVRLPVVLLAMAACLASVALGSLHVEESLEMRFAAFKKKYGKVYKDAKEEAF
RFRAFEENMEQAKIQAAANPYATFGVTPFSDMTREEFRARYRNGASYFAAAQKRLRKTVN
VTTGRAPAAVDWREKGAVTPVKDQGQCGSCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVS
CDTIDFGCGGGLMDNAFNWIVNSNGGNVFTEASYPYVSGNGEQPQCQMNGHEIGAAITDH
VDLPQDEDAIAAYLAENGPLAIAVDATSFMDYNGGILTSCTSEQLDHGVLLVGYNDSSNP
PYWIIKNSWSNMWGEDGYIRIEKGTNQCLMNQAVSSAVVGGPTPPPPPPPPPSATFTQDF
CEGKGCTKGCSHATFPTGECVQTTGVGSVIATCGASNLTQIIYPLSRSCSGLSVPITVPL
DKCIPILIGSVEYHCSTNPPTKAARLVPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183742
n/a
NameBDBM50183742
Synonyms:(2R,3R)-diethyl 1-(6-(5-((3aS,4S,6aR)-2-oxo-hexahydro-1H-thieno[3,4-d]imidazol-4-yl)pentanamido)hexanoyl)aziridine-2,3-dicarboxylate | CHEMBL206415
TypeSmall organic molecule
Emp. Form.C24H38N4O7S
Mol. Mass.526.646
SMILESCCOC(=O)[C@H]1[C@@H](N1C(=O)CCCCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12)C(=O)OCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: