Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhodesain
LigandBDBM50183779
Substrate/Competitorn/a
Meas. Tech.ChEMBL_350622
Ki 500±n/a nM
Citation Vicik RHoerr VGlaser MSchultheis MHansell EMcKerrow JHHolzgrabe UCaffrey CRPonte-Sucre AMoll HStich ASchirmeister T Aziridine-2,3-dicarboxylate inhibitors targeting the major cysteine protease of Trypanosoma brucei as lead trypanocidal agents. Bioorg Med Chem Lett 16:2753-7 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Rhodesain
Name:Rhodesain
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:48425.78
Organism:Trypanosoma brucei rhodesiense
Description:ChEMBL_619861
Residue:450
Sequence:
MPRTEMVRFVRLPVVLLAMAACLASVALGSLHVEESLEMRFAAFKKKYGKVYKDAKEEAF
RFRAFEENMEQAKIQAAANPYATFGVTPFSDMTREEFRARYRNGASYFAAAQKRLRKTVN
VTTGRAPAAVDWREKGAVTPVKDQGQCGSCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVS
CDTIDFGCGGGLMDNAFNWIVNSNGGNVFTEASYPYVSGNGEQPQCQMNGHEIGAAITDH
VDLPQDEDAIAAYLAENGPLAIAVDATSFMDYNGGILTSCTSEQLDHGVLLVGYNDSSNP
PYWIIKNSWSNMWGEDGYIRIEKGTNQCLMNQAVSSAVVGGPTPPPPPPPPPSATFTQDF
CEGKGCTKGCSHATFPTGECVQTTGVGSVIATCGASNLTQIIYPLSRSCSGLSVPITVPL
DKCIPILIGSVEYHCSTNPPTKAARLVPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183779
n/a
NameBDBM50183779
Synonyms:(2S,3S)-1-((S)-2-((S)-2-(tert-butoxycarbonyl)-3-phenylpropanamido)propanoyl)aziridine-2,3-dicarboxylic acid | CHEMBL379649
TypeSmall organic molecule
Emp. Form.C21H27N3O8
Mol. Mass.449.4544
SMILESC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)OC(C)(C)C)C(=O)N1[C@@H]([C@H]1C(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: