Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhodesain
LigandBDBM50183767
Substrate/Competitorn/a
Meas. Tech.ChEMBL_350622
Ki 500±n/a nM
Citation Vicik RHoerr VGlaser MSchultheis MHansell EMcKerrow JHHolzgrabe UCaffrey CRPonte-Sucre AMoll HStich ASchirmeister T Aziridine-2,3-dicarboxylate inhibitors targeting the major cysteine protease of Trypanosoma brucei as lead trypanocidal agents. Bioorg Med Chem Lett 16:2753-7 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Rhodesain
Name:Rhodesain
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:48425.78
Organism:Trypanosoma brucei rhodesiense
Description:ChEMBL_619861
Residue:450
Sequence:
MPRTEMVRFVRLPVVLLAMAACLASVALGSLHVEESLEMRFAAFKKKYGKVYKDAKEEAF
RFRAFEENMEQAKIQAAANPYATFGVTPFSDMTREEFRARYRNGASYFAAAQKRLRKTVN
VTTGRAPAAVDWREKGAVTPVKDQGQCGSCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVS
CDTIDFGCGGGLMDNAFNWIVNSNGGNVFTEASYPYVSGNGEQPQCQMNGHEIGAAITDH
VDLPQDEDAIAAYLAENGPLAIAVDATSFMDYNGGILTSCTSEQLDHGVLLVGYNDSSNP
PYWIIKNSWSNMWGEDGYIRIEKGTNQCLMNQAVSSAVVGGPTPPPPPPPPPSATFTQDF
CEGKGCTKGCSHATFPTGECVQTTGVGSVIATCGASNLTQIIYPLSRSCSGLSVPITVPL
DKCIPILIGSVEYHCSTNPPTKAARLVPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183767
n/a
NameBDBM50183767
Synonyms:(2R,3R)-dibenzyl 1-((S)-1-((S)-2-(tert-butoxycarbonyl)-4-methylpentanoyl)pyrrolidine-5-carbonyl)aziridine-2,3-dicarboxylate | CHEMBL383647
TypeSmall organic molecule
Emp. Form.C34H43N3O8
Mol. Mass.621.7205
SMILESCC(C)C[C@H](NC(=O)OC(C)(C)C)C(=O)N1CCC[C@H]1C(=O)N1[C@H]([C@@H]1C(=O)OCc1ccccc1)C(=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: