Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C
LigandBDBM50183805
Substrate/Competitorn/a
Meas. Tech.ChEMBL_353750
IC50 0.05±n/a nM
Citation Lacombe PDeschênes DDubé DDubé LGallant MMacdonald DMastracchio APerrier HCharleson SHuang ZLaliberté FLiu SMancini JAMasson PSalem MStyhler AGirard Y Nitrogen-bridged substituted 8-arylquinolines as potent PDE IV inhibitors. Bioorg Med Chem Lett 16:2608-12 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4C
Name:Phosphodiesterase 4 and 5 (PDE4 and PDE5)
Synonyms:DPDE1 | PDE21 | PDE4C2 | Phosphodiesterase 4C
Type:PROTEIN
Mol. Mass.:79875.54
Organism:Homo sapiens (Human)
Description:ChEMBL_864910
Residue:712
Sequence:
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERD
LSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESF
LYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGA
AKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRI
LNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSA
SLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLL
KTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNL
SAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQN
LVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGF
IDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFEL
TLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183805
n/a
NameBDBM50183805
Synonyms:1-((3-(6-(2-cyanopropan-2-yl)quinolin-8-yl)phenyl)methyl)-1-(4-(methylsulfonyl)phenyl)-3-phenylurea | CHEMBL380321
TypeSmall organic molecule
Emp. Form.C34H30N4O3S
Mol. Mass.574.692
SMILESCC(C)(C#N)c1cc(-c2cccc(CN(C(=O)Nc3ccccc3)c3ccc(cc3)S(C)(=O)=O)c2)c2ncccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: