Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50184192
Substrate/Competitorn/a
Meas. Tech.ChEMBL_350972
Ki 52±n/a nM
Citation Kuduk SDDi Marco CNChang RKWood MRKim JJSchirripa KMMurphy KLRansom RWTang CTorrent MHa SPrueksaritanont TPettibone DJBock MG 5-Piperazinyl pyridine carboxamide bradykinin B1 antagonists. Bioorg Med Chem Lett 16:2791-5 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184192
n/a
NameBDBM50184192
Synonyms:3,3'-difluoro-4'-({5-[4-(2,2,2-trifluoro-ethyl)-piperazine-1-carbonyl]-pyridin-2-ylamino}-methyl)-biphenyl-2-carboxylic acid methyl ester | CHEMBL382909
TypeSmall organic molecule
Emp. Form.C27H25F5N4O3
Mol. Mass.548.5044
SMILESCOC(=O)c1c(F)cccc1-c1ccc(CNc2ccc(cn2)C(=O)N2CCN(CC(F)(F)F)CC2)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: