Reaction Details |
| Report a problem with these data |
Target | Thromboxane A2 receptor |
---|
Ligand | BDBM50184213 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_364758 (CHEMBL871220) |
---|
Ki | 9.1±n/a nM |
---|
Citation | Sturino, CF; Lachance, N; Boyd, M; Berthelette, C; Labelle, M; Li, L; Roy, B; Scheigetz, J; Tsou, N; Brideau, C; Cauchon, E; Carriere, MC; Denis, D; Greig, G; Kargman, S; Lamontagne, S; Mathieu, MC; Sawyer, N; Slipetz, D; O'Neill, G; Wang, Z; Zamboni, R; Metters, KM; Young, RN Identification of an indole series of prostaglandin D2 receptor antagonists. Bioorg Med Chem Lett16:3043-8 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thromboxane A2 receptor |
---|
Name: | Thromboxane A2 receptor |
Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
Type: | Enyzme |
Mol. Mass.: | 37445.28 |
Organism: | Homo sapiens (Human) |
Description: | P21731 |
Residue: | 343 |
Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
BDBM50184213 |
---|
n/a |
---|
Name | BDBM50184213 |
Synonyms: | 2-(9-(4-chlorobenzyl)-8-isopropyl-2,3,4,9-tetrahydro-1H-carbazol-1-yl)acetic acid | CHEMBL267820 |
Type | Small organic molecule |
Emp. Form. | C24H26ClNO2 |
Mol. Mass. | 395.922 |
SMILES | CC(C)c1cccc2c3CCCC(CC(O)=O)c3n(Cc3ccc(Cl)cc3)c12 |
Structure |
|