Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid TP receptor
LigandBDBM50184244
Substrate/Competitorn/a
Meas. Tech.ChEMBL_364758
Ki 2.2±n/a nM
Citation Sturino CFLachance NBoyd MBerthelette CLabelle MLi LRoy BScheigetz JTsou NBrideau CCauchon ECarriere MCDenis DGreig GKargman SLamontagne SMathieu MCSawyer NSlipetz DO'Neill GWang ZZamboni RMetters KMYoung RN Identification of an indole series of prostaglandin D2 receptor antagonists. Bioorg Med Chem Lett 16:3043-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid TP receptor
Name:Thromboxane A2 receptor
Synonyms:TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta
Type:Enyzme
Mol. Mass.:37445.28
Organism:Homo sapiens (Human)
Description:P21731
Residue:343
Sequence:
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184244
n/a
NameBDBM50184244
Synonyms:2-(9-(4-chlorobenzyl)-8-bromo-2,3,4,9-tetrahydro-1H-carbazol-1-yl)acetic acid | CHEMBL378125
TypeSmall organic molecule
Emp. Form.C21H19BrClNO2
Mol. Mass.432.738
SMILESOC(=O)CC1CCCc2c1n(Cc1ccc(Cl)cc1)c1c(Br)cccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: