Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTerminal deoxynucleotidyltransferase
LigandBDBM50184758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_356789
IC50 8600±n/a nM
Citation Doncaster JREtchells LLKershaw NMNakamura RRyan HTakeuchi RSakaguchi KSardarian AWhitehead RC Synthetic analogues of the manzamenones and plakoridines which inhibit DNA polymerase. Bioorg Med Chem Lett 16:2877-81 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Terminal deoxynucleotidyltransferase
Name:Terminal deoxynucleotidyltransferase
Synonyms:DNA nucleotidylexotransferase | Terminal addition enzyme | Terminal transferase
Type:PROTEIN
Mol. Mass.:58545.66
Organism:Homo sapiens (Human)
Description:ChEMBL_210231
Residue:509
Sequence:
MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKG
FRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMT
GKHQLVVRRDYSDSTNPGPPKTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCE
FRENEDSCVTFMRAASVLKSLPFTIISMKDTEGIPCLGSKVKGIIEEIIEDGESSEVKAV
LNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSDKSLKFTRMQKAGFLYYEDLV
SCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITSPGSTEDEEQL
LQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSS
WQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKT
KRIFLKAESEEEIFAHLGLDYIEPWERNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184758
n/a
NameBDBM50184758
Synonyms:(3aS,4S,7R,7aR)-1,6-didodecyl-2,7-bis(methoxycarbonyl)-3-oxo-3a,4,7,7a-tetrahydro-3H-indene-4-carboxylic acid | CHEMBL210047
TypeSmall organic molecule
Emp. Form.C38H62O7
Mol. Mass.630.8947
SMILESCCCCCCCCCCCCC1=C(C(=O)OC)C(=O)[C@H]2[C@@H]1[C@@H](C(=O)OC)C(CCCCCCCCCCCC)=C[C@@H]2C(O)=O |c:12,40|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: