Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnandamide amidohydrolase
LigandBDBM50185015
Substrate/Competitorn/a
Meas. Tech.ChEMBL_342906
IC50>50000±n/a nM
Citation Schiano Moriello ABalas LLigresti ACascio MGDurand TMorera EOrtar GDi Marzo V Development of the first potential covalent inhibitors of anandamide cellular uptake. J Med Chem 49:2320-32 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Anandamide amidohydrolase
Name:Anandamide amidohydrolase
Synonyms:Anandamide amidohydrolase 1 | FAAH | Fatty Acid Amide Hydrolase | Fatty Acid Amide Hydrolic, FAAH | Fatty-acid amide hydrolase (FAAH) | Fatty-acid amide hydrolase 1 | Fatty-acid amide hydrolase 1 (FAAH) | Oleamide hydrolase 1
Type:Single-pass membrane protein; homodimer
Mol. Mass.:63364.46
Organism:Rattus norvegicus (rat)
Description:Membranes prepared from rat brain were used in assay.
Residue:579
Sequence:
MVLSEVWTTLSGVSGVCLACSLLSAAVVLRWTGRQKARGAATRARQKQRASLETMDKAVQ
RFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCE
HLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTL
IPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSL
LLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMK
NSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50185015
n/a
NameBDBM50185015
Synonyms:(Z)-N-{(1S)-3-(2,6-dichlorobenzoyloxy)-1-[(4-hydroxyphenyl)-methyl]propan-2-one}-9-octadecenamide | CHEMBL380757
TypeSmall organic molecule
Emp. Form.C35H47Cl2NO5
Mol. Mass.632.657
SMILESCCCCCCCC\C=C/CCCCCCCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)COC(=O)c1c(Cl)cccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: