Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanin-concentrating hormone receptor
LigandBDBM50185040
Substrate/Competitorn/a
Meas. Tech.ChEMBL_343377
IC50 3±n/a nM
Citation Kym PRSouers AJCampbell TJLynch JKJudd ASIyengar RVasudevan AGao JFreeman JCWodka DMulhern MZhao GWagaw SHNapier JJBrodjian SDayton BDReilly RMSegreti JAFryer RMPreusser LCReinhart GAHernandez LMarsh KCSham HLCollins CAPolakowski JS Screening for cardiovascular safety: a structure-activity approach for guiding lead selection of melanin concentrating hormone receptor 1 antagonists. J Med Chem 49:2339-52 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanin-concentrating hormone receptor
Name:Melanin-concentrating hormone receptor
Synonyms:G-protein coupled receptor 24 | GPR24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCHR | MCHR-1 | Melanin Concentrating Hormone 1 | Melanin-Concentrating Hormone Receptor 1 (MCH1R) | Melanin-concentrating hormone receptor 1 (MCH-1) | Melanin-concentrating hormone receptor 1 (MCH1) | Melanin-concentrating hormone receptor 1 (MCHR-1) | Melanin-concentrating hormone receptor 1 (MCHR1) | SLC-1 | Somatostatin receptor-like protein
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45976.27
Organism:Homo sapiens (Human)
Description:Membranes from CHO-K1 cells stably expressing human MCH1R were used in assays.
Residue:422
Sequence:
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50185040
n/a
NameBDBM50185040
Synonyms:CHEMBL204828 | N-[1-(1,3-benzodioxol-5-ylmethyl)piperidin-4-yl]-6,7-dichloro-4-oxo-4H-chromene-2-carboxamide
TypeSmall organic molecule
Emp. Form.C23H20Cl2N2O5
Mol. Mass.475.321
SMILESClc1cc2oc(cc(=O)c2cc1Cl)C(=O)NC1CCN(Cc2ccc3OCOc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: