Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 5
LigandBDBM22209
Substrate/Competitorn/a
Meas. Tech.ChEMBL_374030
IC50 1±n/a nM
Citation Yan LBudhu RHuo PLynch CLHale JJMills SGHajdu RKeohane CARosenbach MJMilligan JAShei GJChrebet GBergstrom JCard DMandala SM 2-Aryl(pyrrolidin-4-yl)acetic acids are potent agonists of sphingosine-1-phosphate (S1P) receptors. Bioorg Med Chem Lett 16:3564-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 5
Name:Sphingosine 1-phosphate receptor 5
Synonyms:Endothelial differentiation sphingolipid G-protein-coupled receptor 8 | S1P5 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-8
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41796.42
Organism:Homo sapiens (Human)
Description:n/a
Residue:398
Sequence:
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22209
n/a
NameBDBM22209
Synonyms:1,2,4-oxadiazole based compound, 26 | 1-[(4-{5-[4-(2-methylpropyl)phenyl]-1,2,4-oxadiazol-3-yl}phenyl)methyl]azetidine-3-carboxylic acid | CHEMBL194419
TypeSmall organic molecule
Emp. Form.C23H25N3O3
Mol. Mass.391.4629
SMILESCC(C)Cc1ccc(cc1)-c1nc(no1)-c1ccc(CN2CC(C2)C(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: