Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 5
LigandBDBM50185979
Substrate/Competitorn/a
Meas. Tech.ChEMBL_351943
IC50 0.42±n/a nM
Citation Imamura SIchikawa TNishikawa YKanzaki NTakashima KNiwa SIizawa YBaba MSugihara Y Discovery of a piperidine-4-carboxamide CCR5 antagonist (TAK-220) with highly potent Anti-HIV-1 activity. J Med Chem 49:2784-93 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 5
Name:CCR5/mu opioid receptor complex
Synonyms:C-C CKR-5 | CC-CKR-5 | CCR-5 | CCR5/mu opioid receptor complex | CD_antigen=CD195 | CHEMR13 | HIV-1 fusion coreceptor
Type:Enzyme
Mol. Mass.:40540.21
Organism:Homo sapiens (Human)
Description:P51681
Residue:352
Sequence:
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50185979
n/a
NameBDBM50185979
Synonyms:1-acetyl-N-{3-[4-(4-carbamoylbenzyl)piperidin-1-yl]propyl}-N-(3-chloro-4-methylphenyl)piperidine-4-carboxamide | CHEMBL207004 | TAK-220
TypeSmall organic molecule
Emp. Form.C31H41ClN4O3
Mol. Mass.553.135
SMILESCC(=O)N1CCC(CC1)C(=O)N(CCCN1CCC(Cc2ccc(cc2)C(N)=O)CC1)c1ccc(C)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: